Eintrag weiter verarbeiten
Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma
Gespeichert in:
| Zeitschriftentitel: | International Journal of Cancer |
|---|---|
| Personen und Körperschaften: | , , , , , , |
| In: | International Journal of Cancer, 114, 2005, 2, S. 242-248 |
| Format: | E-Article |
| Sprache: | Englisch |
| veröffentlicht: |
Wiley
|
| Schlagwörter: |
| author_facet |
Pedrero, Juana Maria Garcia Carracedo, Dario Garcia Pinto, Cristina Muñoz Zapatero, Agustín Herrero Rodrigo, Juan Pablo Nieto, Carlos Suarez Gonzalez, Maria Victoria Pedrero, Juana Maria Garcia Carracedo, Dario Garcia Pinto, Cristina Muñoz Zapatero, Agustín Herrero Rodrigo, Juan Pablo Nieto, Carlos Suarez Gonzalez, Maria Victoria |
|---|---|
| author |
Pedrero, Juana Maria Garcia Carracedo, Dario Garcia Pinto, Cristina Muñoz Zapatero, Agustín Herrero Rodrigo, Juan Pablo Nieto, Carlos Suarez Gonzalez, Maria Victoria |
| spellingShingle |
Pedrero, Juana Maria Garcia Carracedo, Dario Garcia Pinto, Cristina Muñoz Zapatero, Agustín Herrero Rodrigo, Juan Pablo Nieto, Carlos Suarez Gonzalez, Maria Victoria International Journal of Cancer Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma Cancer Research Oncology |
| author_sort |
pedrero, juana maria garcia |
| spelling |
Pedrero, Juana Maria Garcia Carracedo, Dario Garcia Pinto, Cristina Muñoz Zapatero, Agustín Herrero Rodrigo, Juan Pablo Nieto, Carlos Suarez Gonzalez, Maria Victoria 0020-7136 1097-0215 Wiley Cancer Research Oncology http://dx.doi.org/10.1002/ijc.20711 <jats:title>Abstract</jats:title><jats:p>We investigated the status of the PI 3‐kinase/AKT/PTEN signaling pathway in a series of 117 head and neck squamous cell carcinomas (HNSCC) in a search for molecular alterations in genes/proteins with potential prognostic value. For this purpose, <jats:italic>PIK3CA</jats:italic> and <jats:italic>AKT2</jats:italic> gene amplification was assessed by multiplex and Quantitative Real‐Time PCR. Protein expression of AKT, p‐AKT, p110α and PTEN was determined by Western blot. <jats:italic>PTEN</jats:italic> allelic loss was evaluated by microsatellite analysis. <jats:italic>PTEN</jats:italic>‐exon 5 was screened for point mutations by PCR‐SSCP. Homozygous deletions were determined by multiplex PCR. <jats:italic>PIK3CA</jats:italic> gene was amplified in 43/117 (37%) fresh tumor samples, a frequency that did not differ from that found in archival premalignant tissues: 15/38 (39%); 12/40 (30%) fresh tumors harbored <jats:italic>AKT2</jats:italic> gene amplification. AKT was found activated in 6/36 (17%) fresh tumor samples, when compared to their normal tissue counterparts. Of these 6 cases, 1 showed p110α overexpression and 5 displayed PTEN protein downregulation. Neither allelic loss (found in 11/77 informative cases) nor point mutations or homozygous deletions accounted for the reduced PTEN protein expression observed in our tumor series. The histologically normal mucosa of 4 patients displayed some of the molecular alterations analyzed. Dysregulation of the PI 3‐K/AKT/PTEN pathway might contribute to early HNSCC tumorigenesis and might constitute a potential clinical target. Overall, 17/36 (47%) cases showed at least 1 of the molecular alterations studied here, which makes the PI 3‐kinase‐initiated signaling pathway one of the most frequently altered in HNSCC. © 2004 Wiley‐Liss, Inc.</jats:p> Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma International Journal of Cancer |
| doi_str_mv |
10.1002/ijc.20711 |
| facet_avail |
Online Free |
| finc_class_facet |
Medizin |
| format |
ElectronicArticle |
| fullrecord |
blob:ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAwMi9pamMuMjA3MTE |
| id |
ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAwMi9pamMuMjA3MTE |
| institution |
DE-D275 DE-Bn3 DE-Brt1 DE-Zwi2 DE-D161 DE-Gla1 DE-Zi4 DE-15 DE-Pl11 DE-Rs1 DE-105 DE-14 DE-Ch1 DE-L229 |
| imprint |
Wiley, 2005 |
| imprint_str_mv |
Wiley, 2005 |
| issn |
0020-7136 1097-0215 |
| issn_str_mv |
0020-7136 1097-0215 |
| language |
English |
| mega_collection |
Wiley (CrossRef) |
| match_str |
pedrero2005retractedfrequentgeneticandbiochemicalalterationsofthepi3kaktptenpathwayinheadandnecksquamouscellcarcinoma |
| publishDateSort |
2005 |
| publisher |
Wiley |
| recordtype |
ai |
| record_format |
ai |
| series |
International Journal of Cancer |
| source_id |
49 |
| title |
Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_unstemmed |
Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_full |
Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_fullStr |
Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_full_unstemmed |
Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_short |
Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_sort |
retracted: frequent genetic and biochemical alterations of the pi 3‐k/akt/pten pathway in head and neck squamous cell carcinoma |
| topic |
Cancer Research Oncology |
| url |
http://dx.doi.org/10.1002/ijc.20711 |
| publishDate |
2005 |
| physical |
242-248 |
| description |
<jats:title>Abstract</jats:title><jats:p>We investigated the status of the PI 3‐kinase/AKT/PTEN signaling pathway in a series of 117 head and neck squamous cell carcinomas (HNSCC) in a search for molecular alterations in genes/proteins with potential prognostic value. For this purpose, <jats:italic>PIK3CA</jats:italic> and <jats:italic>AKT2</jats:italic> gene amplification was assessed by multiplex and Quantitative Real‐Time PCR. Protein expression of AKT, p‐AKT, p110α and PTEN was determined by Western blot. <jats:italic>PTEN</jats:italic> allelic loss was evaluated by microsatellite analysis. <jats:italic>PTEN</jats:italic>‐exon 5 was screened for point mutations by PCR‐SSCP. Homozygous deletions were determined by multiplex PCR. <jats:italic>PIK3CA</jats:italic> gene was amplified in 43/117 (37%) fresh tumor samples, a frequency that did not differ from that found in archival premalignant tissues: 15/38 (39%); 12/40 (30%) fresh tumors harbored <jats:italic>AKT2</jats:italic> gene amplification. AKT was found activated in 6/36 (17%) fresh tumor samples, when compared to their normal tissue counterparts. Of these 6 cases, 1 showed p110α overexpression and 5 displayed PTEN protein downregulation. Neither allelic loss (found in 11/77 informative cases) nor point mutations or homozygous deletions accounted for the reduced PTEN protein expression observed in our tumor series. The histologically normal mucosa of 4 patients displayed some of the molecular alterations analyzed. Dysregulation of the PI 3‐K/AKT/PTEN pathway might contribute to early HNSCC tumorigenesis and might constitute a potential clinical target. Overall, 17/36 (47%) cases showed at least 1 of the molecular alterations studied here, which makes the PI 3‐kinase‐initiated signaling pathway one of the most frequently altered in HNSCC. © 2004 Wiley‐Liss, Inc.</jats:p> |
| container_issue |
2 |
| container_start_page |
242 |
| container_title |
International Journal of Cancer |
| container_volume |
114 |
| format_de105 |
Article, E-Article |
| format_de14 |
Article, E-Article |
| format_de15 |
Article, E-Article |
| format_de520 |
Article, E-Article |
| format_de540 |
Article, E-Article |
| format_dech1 |
Article, E-Article |
| format_ded117 |
Article, E-Article |
| format_degla1 |
E-Article |
| format_del152 |
Buch |
| format_del189 |
Article, E-Article |
| format_dezi4 |
Article |
| format_dezwi2 |
Article, E-Article |
| format_finc |
Article, E-Article |
| format_nrw |
Article, E-Article |
| _version_ |
1792347443388481544 |
| geogr_code |
not assigned |
| last_indexed |
2024-03-01T17:55:22.662Z |
| geogr_code_person |
not assigned |
| openURL |
url_ver=Z39.88-2004&ctx_ver=Z39.88-2004&ctx_enc=info%3Aofi%2Fenc%3AUTF-8&rfr_id=info%3Asid%2Fvufind.svn.sourceforge.net%3Agenerator&rft.title=Retracted%3A+Frequent+genetic+and+biochemical+alterations+of+the+PI+3%E2%80%90K%2FAKT%2FPTEN+pathway+in+head+and+neck+squamous+cell+carcinoma&rft.date=2005-03-20&genre=article&issn=1097-0215&volume=114&issue=2&spage=242&epage=248&pages=242-248&jtitle=International+Journal+of+Cancer&atitle=Retracted%3A+Frequent+genetic+and+biochemical+alterations+of+the+PI+3%E2%80%90K%2FAKT%2FPTEN+pathway+in+head+and+neck+squamous+cell+carcinoma&aulast=Gonzalez&aufirst=Maria+Victoria&rft_id=info%3Adoi%2F10.1002%2Fijc.20711&rft.language%5B0%5D=eng |
| SOLR | |
| _version_ | 1792347443388481544 |
| author | Pedrero, Juana Maria Garcia, Carracedo, Dario Garcia, Pinto, Cristina Muñoz, Zapatero, Agustín Herrero, Rodrigo, Juan Pablo, Nieto, Carlos Suarez, Gonzalez, Maria Victoria |
| author_facet | Pedrero, Juana Maria Garcia, Carracedo, Dario Garcia, Pinto, Cristina Muñoz, Zapatero, Agustín Herrero, Rodrigo, Juan Pablo, Nieto, Carlos Suarez, Gonzalez, Maria Victoria, Pedrero, Juana Maria Garcia, Carracedo, Dario Garcia, Pinto, Cristina Muñoz, Zapatero, Agustín Herrero, Rodrigo, Juan Pablo, Nieto, Carlos Suarez, Gonzalez, Maria Victoria |
| author_sort | pedrero, juana maria garcia |
| container_issue | 2 |
| container_start_page | 242 |
| container_title | International Journal of Cancer |
| container_volume | 114 |
| description | <jats:title>Abstract</jats:title><jats:p>We investigated the status of the PI 3‐kinase/AKT/PTEN signaling pathway in a series of 117 head and neck squamous cell carcinomas (HNSCC) in a search for molecular alterations in genes/proteins with potential prognostic value. For this purpose, <jats:italic>PIK3CA</jats:italic> and <jats:italic>AKT2</jats:italic> gene amplification was assessed by multiplex and Quantitative Real‐Time PCR. Protein expression of AKT, p‐AKT, p110α and PTEN was determined by Western blot. <jats:italic>PTEN</jats:italic> allelic loss was evaluated by microsatellite analysis. <jats:italic>PTEN</jats:italic>‐exon 5 was screened for point mutations by PCR‐SSCP. Homozygous deletions were determined by multiplex PCR. <jats:italic>PIK3CA</jats:italic> gene was amplified in 43/117 (37%) fresh tumor samples, a frequency that did not differ from that found in archival premalignant tissues: 15/38 (39%); 12/40 (30%) fresh tumors harbored <jats:italic>AKT2</jats:italic> gene amplification. AKT was found activated in 6/36 (17%) fresh tumor samples, when compared to their normal tissue counterparts. Of these 6 cases, 1 showed p110α overexpression and 5 displayed PTEN protein downregulation. Neither allelic loss (found in 11/77 informative cases) nor point mutations or homozygous deletions accounted for the reduced PTEN protein expression observed in our tumor series. The histologically normal mucosa of 4 patients displayed some of the molecular alterations analyzed. Dysregulation of the PI 3‐K/AKT/PTEN pathway might contribute to early HNSCC tumorigenesis and might constitute a potential clinical target. Overall, 17/36 (47%) cases showed at least 1 of the molecular alterations studied here, which makes the PI 3‐kinase‐initiated signaling pathway one of the most frequently altered in HNSCC. © 2004 Wiley‐Liss, Inc.</jats:p> |
| doi_str_mv | 10.1002/ijc.20711 |
| facet_avail | Online, Free |
| finc_class_facet | Medizin |
| format | ElectronicArticle |
| format_de105 | Article, E-Article |
| format_de14 | Article, E-Article |
| format_de15 | Article, E-Article |
| format_de520 | Article, E-Article |
| format_de540 | Article, E-Article |
| format_dech1 | Article, E-Article |
| format_ded117 | Article, E-Article |
| format_degla1 | E-Article |
| format_del152 | Buch |
| format_del189 | Article, E-Article |
| format_dezi4 | Article |
| format_dezwi2 | Article, E-Article |
| format_finc | Article, E-Article |
| format_nrw | Article, E-Article |
| geogr_code | not assigned |
| geogr_code_person | not assigned |
| id | ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAwMi9pamMuMjA3MTE |
| imprint | Wiley, 2005 |
| imprint_str_mv | Wiley, 2005 |
| institution | DE-D275, DE-Bn3, DE-Brt1, DE-Zwi2, DE-D161, DE-Gla1, DE-Zi4, DE-15, DE-Pl11, DE-Rs1, DE-105, DE-14, DE-Ch1, DE-L229 |
| issn | 0020-7136, 1097-0215 |
| issn_str_mv | 0020-7136, 1097-0215 |
| language | English |
| last_indexed | 2024-03-01T17:55:22.662Z |
| match_str | pedrero2005retractedfrequentgeneticandbiochemicalalterationsofthepi3kaktptenpathwayinheadandnecksquamouscellcarcinoma |
| mega_collection | Wiley (CrossRef) |
| physical | 242-248 |
| publishDate | 2005 |
| publishDateSort | 2005 |
| publisher | Wiley |
| record_format | ai |
| recordtype | ai |
| series | International Journal of Cancer |
| source_id | 49 |
| spelling | Pedrero, Juana Maria Garcia Carracedo, Dario Garcia Pinto, Cristina Muñoz Zapatero, Agustín Herrero Rodrigo, Juan Pablo Nieto, Carlos Suarez Gonzalez, Maria Victoria 0020-7136 1097-0215 Wiley Cancer Research Oncology http://dx.doi.org/10.1002/ijc.20711 <jats:title>Abstract</jats:title><jats:p>We investigated the status of the PI 3‐kinase/AKT/PTEN signaling pathway in a series of 117 head and neck squamous cell carcinomas (HNSCC) in a search for molecular alterations in genes/proteins with potential prognostic value. For this purpose, <jats:italic>PIK3CA</jats:italic> and <jats:italic>AKT2</jats:italic> gene amplification was assessed by multiplex and Quantitative Real‐Time PCR. Protein expression of AKT, p‐AKT, p110α and PTEN was determined by Western blot. <jats:italic>PTEN</jats:italic> allelic loss was evaluated by microsatellite analysis. <jats:italic>PTEN</jats:italic>‐exon 5 was screened for point mutations by PCR‐SSCP. Homozygous deletions were determined by multiplex PCR. <jats:italic>PIK3CA</jats:italic> gene was amplified in 43/117 (37%) fresh tumor samples, a frequency that did not differ from that found in archival premalignant tissues: 15/38 (39%); 12/40 (30%) fresh tumors harbored <jats:italic>AKT2</jats:italic> gene amplification. AKT was found activated in 6/36 (17%) fresh tumor samples, when compared to their normal tissue counterparts. Of these 6 cases, 1 showed p110α overexpression and 5 displayed PTEN protein downregulation. Neither allelic loss (found in 11/77 informative cases) nor point mutations or homozygous deletions accounted for the reduced PTEN protein expression observed in our tumor series. The histologically normal mucosa of 4 patients displayed some of the molecular alterations analyzed. Dysregulation of the PI 3‐K/AKT/PTEN pathway might contribute to early HNSCC tumorigenesis and might constitute a potential clinical target. Overall, 17/36 (47%) cases showed at least 1 of the molecular alterations studied here, which makes the PI 3‐kinase‐initiated signaling pathway one of the most frequently altered in HNSCC. © 2004 Wiley‐Liss, Inc.</jats:p> Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma International Journal of Cancer |
| spellingShingle | Pedrero, Juana Maria Garcia, Carracedo, Dario Garcia, Pinto, Cristina Muñoz, Zapatero, Agustín Herrero, Rodrigo, Juan Pablo, Nieto, Carlos Suarez, Gonzalez, Maria Victoria, International Journal of Cancer, Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma, Cancer Research, Oncology |
| title | Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_full | Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_fullStr | Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_full_unstemmed | Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_short | Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| title_sort | retracted: frequent genetic and biochemical alterations of the pi 3‐k/akt/pten pathway in head and neck squamous cell carcinoma |
| title_unstemmed | Retracted: Frequent genetic and biochemical alterations of the PI 3‐K/AKT/PTEN pathway in head and neck squamous cell carcinoma |
| topic | Cancer Research, Oncology |
| url | http://dx.doi.org/10.1002/ijc.20711 |